IGF-1 DES 1mg
Application | A truncated version of IGF-1 in which the tripeptide Gly-Pro-Glu is absent from the N-terminus end of the protein. |
CAS | 112603-35-7 |
Molar Mass | 7365.4225/mol |
Chemical Formula | C319H501N91O96S7 |
Amino Acid Sequence | TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKAAKSA |
Synonyms | Insulin-like growth factor 1, des-(1-3)-, Des(1-3) IGF-1, 4-70-insulin-like growth factor 1 |
Storage | Store in refrigerator at 4°C, tightly sealed, away from heat, light and moisture. |
Solubility | Soluble in water |
Organoleptic Profile | Fine white powder in 3mL glass aliquot |
Composition | Each aliquot contains IGF-1 DES 1mg |
Specification | IGF-1 DES content (per aliquot): IGF-1 DES 1mg |
Terms | This material is sold for laboratory research use only. Terms of sale apply. Not for human consumption, nor medical, veterinary, or household uses. Please click the word Research Chemical to better understand what they are. *RESEARCH CHEMICAL. You should also review our Terms & Conditions. |
DISCLAIMER
By purchasing from AP Research you agree that you are purchasing Research Chemicals.
AP Research products are furnished for LABORATORY RESEARCH USE ONLY. This product should only be handled by qualified, and licensed professionals. The product may not be used as a drug, agricultural or pesticidal product, food additive or household chemical – and may not be misbranded as such. All information on this website is available for educational purposes only. Bodily introduction of any kind into humans and/or animals is strictly forbidden by law.
*Research Chemicals ARE NOT DIETARY SUPPLEMENTS THEY ARE *RESEARCH CHEMICALS.
*Research chemicals are chemical substances used by scientists for medical and scientific research purposes. One characteristic of a research chemical is that it is for laboratory research use only; a research chemical is not intended for human or veterinary use. This distinction is required on the labels of research chemicals and is what exempts them from regulation under parts 100-740 in Title 21 of the Code of Federal Regulations (21CFR).
Reviews
There are no reviews yet.